DPCstruct | MC13140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 164 ± 26 aa |
| Standard deviation of domain lengths | 25.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.59 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0123- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2CFQ1 | 3-147 | KISEAQEILSVLGLPPAQQNEISALTLLALCGLKEKDKWTDTTRNSLKISKDIMAFVNRNYKKEQPYAPNTRETFRRQVLHQFLQAR… |
| A0A3L7CNV6 | 4-148 | LEEAKEILKALGMPKQQYNDRSAYTFLALAGLKEEDNWDAATNKPMRIVDMMNFMAEHYGKVYKPNTRETIRKDTIHQFCDGAITVR… |
| A0A6L8FY67 | 308-481 | None |
| A0A421AU26 | 15-156 | None |
| A0A1Z4GYM6 | 532-670 | None |
| K9RBE9 | 9-172 | None |
| A0A1X0ECH9 | 2-240 | None |
| A0A849WXR7 | 9-165 | None |
| A0A6P1AMT0 | 356-516 | None |
| W4LX49 | 4-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.