DPCstruct | MC13139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 101 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12957 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5IQI0 | 1-101 | MEKITYGELKALFLQHEGTRPEKHLTGCIVFTENSFEKPYPLESRSYVVSSDNKAYRSCMGGYSIFAHNLDGSDPHIRLEAYMAEER… |
| A0A3E2Y3Q2 | 1-97 | MKYETLCSIFRKYEESRPRTHLAARICFTEDSFTDPYSEESRTYEISSDNKAFQPNMGGYSIYGSSLDRSDMGVRLEAVMADEKGGP… |
| A0A2A7AJS9 | 7-118 | None |
| A0A1W2AQF1 | 176-282 | None |
| A0A1C6IZS8 | 1-95 | None |
| A0A1Y4HAD6 | 1-96 | None |
| R6V3M1 | 55-160 | None |
| A0A6N9P7I0 | 1-96 | None |
| R5KI50 | 70-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.