DPCstruct | MC13138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 521 ± 75 aa |
| Standard deviation of domain lengths | 74.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5SCU1 | 1-385 | ASVEELAEACANSTFLLLGGLGFSGLNPVYNAEMGLYRATVSTEEDIARSRRFRAIYEKVLASAENIPVIVLTHTQMADWSDARYNP… |
| A0A7X5ICD4 | 8-485 | GPVLVGGDVSANYECLEKFYDSLNDAMSSSPIYSNRAYIVSVFGNHETAFMEWGDDRGQHVDPRFSKKKFDALRRAIEGHPHLVDSF… |
| A0A348VXY4 | 456-997 | None |
| A0A6B9T717 | 67-621 | None |
| A0A3F3PCS9 | 260-728 | None |
| A0A416DSJ3 | 192-881 | None |
| A0A1H9BDJ2 | 43-605 | None |
| A0A7S7M872 | 374-949 | None |
| A0A3A9SF11 | 335-846 | None |
| A0A1G5EZJ1 | 307-738 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.