DPCstruct | MC13131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 123 ± 19 aa |
| Standard deviation of domain lengths | 19.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024VF55 | 82-172 | TISPDIINNAIESSQTYQIIPLTIPNEKNDFLGINCYIDDIGRIKKLPYNSRASRICSTEIYGDAFLSKTYDNEDFKRCDFTISEYD… |
| A0A2T7I8E0 | 94-213 | IDTAGSNYQIIPLTLPSDKTNYLGINCYIDSIGRVKNLPTNSRMTRICSTDIRGDCFISRTYDDEDVFKRVDFTMDDYNELLENPPS… |
| A0A1Q9E6Y7 | 970-1121 | None |
| A0A6G0XYS5 | 80-191 | None |
| A0A0D9QPN0 | 98-218 | None |
| C5KEA9 | 319-457 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.