DPCstruct | MC13130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 148 ± 19 aa |
| Standard deviation of domain lengths | 18.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.81 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0123- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1JA24 | 1-112 | MEEEQERKWGEDEKMKLIKGLELYGIGHFREISENLLPNWSGNDLRVKCMRLIGRQNLQLYKEWKGTADDITHEYERNKAIGMKLDT… |
| A0A059LRH2 | 2-138 | RLNFSPTGMCNAEGDIVQDFFKPKTVILQLQEEQRWGDAEREALYQGIEQYGIGAWRDMLAVFPALARYDEQTLRHKAARLMGAQSL… |
| A0A015K7V5 | 245-407 | None |
| A0A1Y5IH84 | 64-205 | None |
| A0A2J8A1P0 | 3-171 | None |
| I7M8B9 | 157-292 | None |
| A0A433QG46 | 33-205 | None |
| A0A2G4SKU4 | 14-176 | None |
| A0DWP1 | 3-128 | None |
| A0A383WHG3 | 53-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.