DPCstruct | MC1313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 56 ± 6 aa |
| Standard deviation of domain lengths | 6.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U3UTY1 | 1-56 | MYGWIWRHLPGNAWVRALISLLLVLAVVYILFQYVFPWAEPLLPFNDVTVDDGMTS |
| A0A401V0A0 | 1-50 | MYGWLWRHLPGPSVVRALILAVAAFLVLAACFLWVFPAVAPFMPFNETTV |
| A0A2T0T3G8 | 1-51 | None |
| A0A6A0CNI5 | 1-58 | None |
| A0A7Z0AB44 | 1-51 | None |
| A0A1Q5NCI5 | 1-56 | None |
| A0A7T9E4K2 | 1-71 | None |
| A0A2P8CMS7 | 1-53 | None |
| A0A094RYF7 | 1-52 | None |
| A0A1E9PYS1 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.