DPCstruct | MC13129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 82 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444GEU2 | 983-1049 | GRWMDERERQQGRVPLKDVVADCTRRWFQDALKEARAGDAAMQVLVGQMYHSGYGVPRNEQKVRFCR |
| A0A059LNT3 | 1-92 | MQRPRPEVIVMDPEGHIVGGPKKLRSVVADALCRWYREAEQEAMQGDVKAAALLGSMLIEGYGCEANPEKGKEWLEKARRRGYRMQG… |
| A0A454Y2N2 | 94-174 | None |
| A0A6P5THE9 | 45-146 | None |
| A0A7J0FCW7 | 1-74 | None |
| A0A5A7PEI6 | 2-67 | None |
| A0A7J7QE17 | 1-94 | None |
| A0A7J7DMZ1 | 51-141 | None |
| A0A5A7RDI3 | 77-152 | None |
| A0A4S8IXM4 | 6-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.