DPCstruct | MC13127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 3.67 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 75.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02325 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059LJP0 | 4-91 | ENGEIVTLISRAFGGFLQLYLVLLFTRVLVGWFPTFPYWDQQPWMALRQVTDPYLRVFTGLIPPLMGTIDITPMVGFMLLQYLAGMLQ |
| A0A7R7AKA6 | 2-85 | YAFRDFSNVFVWLLTVRITIFWFPNLYWWEMPWYVVVVITDPYLRMWRGLFPGVFGLDLSTILAFMFVQYLQGVIERGIISTLD |
| A0A7S2YY73 | 56-143 | None |
| A0A7J7QDX7 | 38-117 | None |
| C1N2H6 | 128-218 | None |
| A9T1F7 | 1-87 | None |
| A0A7S3CNY8 | 45-126 | None |
| A0A7J7PUV9 | 46-128 | None |
| A0A2P6V7E7 | 100-191 | None |
| A0A150FYQ4 | 74-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.