DPCstruct | MC13126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 249 |
|---|---|
| Mean domain length (aa) | 221 ± 45 aa |
| Standard deviation of domain lengths | 44.57 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.92 |
| Pfam Score | 49.48 |
| Assigned Pfam label(s) | PF07667- PF04750- CL0098- PF04882- PF21534 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059LJB5 | 7-247 | FGFYGLCVLFFGRVWLWHLSPAGSSFPGAKGFGWYFRFLTFWSLTLQLASFGLAALDSLREGRRARERALKAPQPTVDADPSQLATS… |
| A0A7S3CJS6 | 2-186 | LIFCFMMIASNMFQYKLVYFFYYVTLWGLVTTTLAILASIKAAKYRAWQKTAVISGQFALALNLTITPTFWLFLAPIFYPAFPWTFM… |
| A0A6V7PCV9 | 205-521 | None |
| A0A3N4KSD8 | 19-219 | None |
| A0A7S2ATT5 | 1-196 | None |
| A0A820CCP4 | 6-169 | None |
| A0A453E2K3 | 192-455 | None |
| A0A0C2MK56 | 31-215 | None |
| A0A814JRE8 | 175-404 | None |
| A0A438MZN9 | 20-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.