DPCstruct | MC13122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3GSD8 | 4-96 | LIPDFDIDTAVGVQLDVVGEWVGRSRRVATPVTGIYFSWDTERVGWDQGVWQGPYDPNDGFIDLSDEIYRLMLKVKVAINNWDGQND… |
| A0A2E4ZEH3 | 23-141 | KPHIEQLLTVWLEGNQELEDTFINIEKIKDIDESSGVQLDNIGNIIGQPRELVDIAATGFFGFSDDPGAKPFGSVDNGQGGLYYSLF… |
| A0A1A9VZ42 | 173-289 | None |
| A0A843GXF3 | 463-606 | None |
| A0A1Y4CYM9 | 42-171 | None |
| A0A8A6GY57 | 15-134 | None |
| A0A420W5A7 | 6-135 | None |
| A0A1A9WSI5 | 499-606 | None |
| T0P5A7 | 416-528 | None |
| A0A4P7W8Z0 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.