DPCstruct | MC13120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 138 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077L1D0 | 5-144 | QPELNAVAFAVNSTLKNTIPATTSTRGAASFDKGFPPETMVKKLAGGIAPSGYDFNGILNFFGQHQVWQNAGGKYKFNSTIANALGG… |
| A0A225DKG5 | 7-137 | YFDIPFAVGGDLNTIPDATQPSGTVSYEQGYPVGYSTPVGSGGFNVPRTSINQVLNDITTAIQAYQQFGTPPFITTTMNGGTPFSYG… |
| A0A258BAS9 | 2-136 | None |
| A0A7W1T2I1 | 1-159 | None |
| A0A7I7D4V0 | 1-131 | None |
| A0A379GG76 | 3-134 | None |
| A0A401WHM3 | 1-133 | None |
| A0A1Y4GHP3 | 3-128 | None |
| A0A3D9URR3 | 1-149 | None |
| A0A7X1EK32 | 5-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.