DPCstruct | MC1312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 90 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10745 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L5SVY8 | 1-84 | MTKWTPRHEAPAPLEGNVVATIIGGTIVWFVLFLAQLPFYGWYADHGHLWWLWTCLTGSGLGLLGIWYVRARDAAIRRSSESDA |
| A0A7U3USS4 | 1-98 | MSKERTPLREAPEPLEANDVATITVGVIVWFVLFFAQLPFYGWYSDHGHTWFIWTCLAGGSCGLLGLVYVRARRDAIARSRADAPDQ… |
| A0A2L0N3U1 | 1-108 | None |
| A0A505D6A7 | 1-103 | None |
| A0A3N4RQM2 | 1-83 | None |
| A0A0Q7BT49 | 1-77 | None |
| A0A7W3TEV4 | 1-113 | None |
| A0A838LLM1 | 2-70 | None |
| A0A132MYY0 | 144-256 | None |
| A0A7W4VVG3 | 11-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.