DPCstruct | MC13119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 9.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7HFC3 | 96-199 | RLDDELFRFLIFYRAVVNVSNSTSATINKLLTKLIGLPAFVNDYQDMSINIRIVGEPTSVQIAILKNYGLLNRPAGVLANVETVTPS… |
| A0A225DHK1 | 22-117 | DNGIFGGSTSYDLPTETKRIALQLRYFQLTSSGTVPETNRMLAYVFRNFGQAWLIDYHDMAQAYVFNFPVTFDLEYLFNSYDILPRP… |
| A0A7W1T2V8 | 34-123 | None |
| A0A3B0BNM3 | 915-1010 | None |
| A0A348HEA2 | 76-193 | None |
| A0A1Y4CYM9 | 129-238 | None |
| A0A843GXF3 | 572-657 | None |
| A0A077QBZ7 | 51-138 | None |
| A0A0T9RSY9 | 83-191 | None |
| I6DQ06 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.