DPCstruct | MC13118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 6.33 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225DC54 | 3-97 | PPPLVDASGCSFPLDRLLATGGEGAVYTLPNDPDRVAKIYHKPPTAQTVEKLTAMVGLVNPDLLTVAAWPCQLLTGAGSRQVVGFVM… |
| A0A109WD47 | 253-347 | PIEGEIVFRLQNGVPERIRLGKEIGKGGEGRIYETGTPYVAKIYARDCLTVRRREKIRRMLSRSISYAGICWPCAELSNESGDFVGY… |
| A0A1Q2LHB7 | 165-274 | None |
| A0A4C3NJ46 | 3-104 | None |
| A0A521R264 | 1-105 | None |
| A0A3M1GZX8 | 195-288 | None |
| A0A6L3EYX8 | 2-84 | None |
| A0A348XIT6 | 2-104 | None |
| A0A143X1N1 | 151-246 | None |
| A0A176U5U3 | 610-708 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.