DPCstruct | MC13116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07812 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4QWK1 | 1-80 | MKIIFAGPSLPDAAALAGEAIRVLPPATQGDVLTAADQGANVIGLIDGGFEYAAPVWHKEILRALSLGVTVLGAASWARC |
| A0A7T8RVH4 | 1-87 | MKIIVFLGPSLPRSEAASIIDAEFRSPVAQGDVYEATLIRPDAIAIIDGYFGFQPAVWHKEILWAMTQGIHVFGAASMGAWRAVELG |
| A0A7X6CIY9 | 43-119 | None |
| W0BG20 | 31-107 | None |
| A0A1Q9SMK8 | 1-83 | None |
| A0A2L0F7Y9 | 1-87 | None |
| A0A6L4ZT89 | 1-86 | None |
| A0A2A9FGY3 | 1-72 | None |
| A0A1S6LPW3 | 2-78 | None |
| A0A5D0U983 | 57-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.