DPCstruct | MC13114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 550 ± 39 aa |
| Standard deviation of domain lengths | 38.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1ZYX0 | 2-509 | RPHLVVPTALVASLLCARPASADPFEDGALIVPMDTTYQDMGIFLAYGLVYELLRNGVPVRWAIASGKNKDDVDFTATAEDVITNDP… |
| A0A5C7UNQ1 | 1-580 | MKNIVLAVFLLLLIVFHSMAATETIPSGSFIVNLGVTPQTVANGLKPYGMIYDLLKNLHVPIKWVINSSKVKDGADFVYNGKSYSGG… |
| A0A2M8B977 | 8-534 | None |
| A0A316A8L2 | 31-605 | None |
| A0A1S2W3F6 | 3-563 | None |
| A0A1L6LLS6 | 1-526 | None |
| A0A3E0QDC9 | 3-505 | None |
| A0A7Y5LP28 | 1-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.