DPCstruct | MC13113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.30 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7UNA5 | 1-79 | MQNEYKVQEGQTLFDIAIHNFGSIESAFEIAAHSGLGLTDELRAGHIISLPKITKSEQINKYVLRAIANRNITPCTGFN |
| A0A1Q3GQ60 | 4-74 | INIKVQDRQTLLDVAVQYLGDATGAIYLAQLNNISITENLEAGQILKIDTDQVIDSKVVSYLREKDVVPIT |
| A0A0F9QI34 | 1-93 | None |
| A0A359CGL1 | 2-83 | None |
| A0A6F9ZKM7 | 1-81 | None |
| A0A4R1ABP7 | 1-79 | None |
| A0A418QML2 | 6-95 | None |
| A0A401XI05 | 1-84 | None |
| A0A2N2YBV7 | 95-174 | None |
| A0A412TJ76 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.