DPCstruct | MC13112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 229 ± 28 aa |
| Standard deviation of domain lengths | 27.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3ZZZ1 | 134-387 | QKADNPAVQENFVRSWDSGGFTDPTVVSGEMGVRGHQSKQDFQFIVHTAPITHLMEGKGVFSIDAESALTSWDVACTSIVNQSKTFT… |
| A0A5C7UN97 | 39-297 | IFTNQYTDIINVKELFAWQELYWYKPIDQPELSRSNNAVDTRLGQHWKYLVHMMRDPDKLRPEFFSTRFEDIIQKWDVMSTSLVSNE… |
| A0A1F9MX88 | 57-273 | None |
| A0A7D4TXJ1 | 1-249 | None |
| A0A4R5LK19 | 108-398 | None |
| A0A1G1YM68 | 6-235 | None |
| A0A0H5LZS7 | 4-225 | None |
| R5MX49 | 110-308 | None |
| A0A7H8YYU7 | 5-207 | None |
| R6BNF3 | 733-919 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.