DPCstruct | MC13110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 259 ± 33 aa |
| Standard deviation of domain lengths | 32.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16252 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3CSH8 | 1-261 | MAGMMVKEFHVSAAAARVGRAAVFSLIAAATAGFAAPAFAQDTQAAPTFASTRAAKPSAPSQGGTRYVDMGSANDAGFVLEQRGSMV… |
| A3UF16 | 11-206 | RSLWFERADGRGGFTFDRSASMPLIRADDDDEIMAVHQVRAAGGGEVWITDTGRMLLRQSNLGGWTYFPSDRPDGVIVEPVGQAQPL… |
| A0A085WCN5 | 136-369 | None |
| A0A2D5EYB1 | 1-282 | None |
| A0A085WLY8 | 2-270 | None |
| A0A7Y6X0F9 | 1-284 | None |
| A0A3B0RZT1 | 39-318 | None |
| A0A239PIY5 | 1-305 | None |
| A0A202DLF3 | 11-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.