DPCstruct | MC1311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 5 aa |
| Standard deviation of domain lengths | 4.72 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19819 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A542PWY4 | 16-135 | LTIAVLPAREAYDYETFRHRLADVSVLDQSVAIRVFRIPLLAVPAGGRRRGGYFSTASLSVGLAVRGLLQGRPGFTSPRLRWSPYRD… |
| A0A7U3UQN3 | 7-135 | ILPRLVPAYLAYDFEHFARLLADPELLRGAVGVRVHRAPLLAVPIGGTRLGGSMSIDLIVLAEKVHDLLLGLRGFPDLRVLPSPYRS… |
| D9URW8 | 17-131 | None |
| A0A1D2IAV2 | 10-134 | None |
| A0A233SJM6 | 2-116 | None |
| A0A4R9EU94 | 178-303 | None |
| A0A2A2Z6H2 | 3-122 | None |
| A0A2R4SVP1 | 13-132 | None |
| A0A1V3ZZD8 | 17-139 | None |
| A0A1C5D1T4 | 25-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.