DPCstruct | MC13107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 136 ± 15 aa |
| Standard deviation of domain lengths | 15.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5YD46 | 52-171 | RRNIKMREERYKILKLVEEGRIRADEAEELIKKLEEVSKKEKRYLRVNVVEKERNIVNITVPLSFLSWGLKFASTYAGKYGEKIEIS… |
| A9B6Z1 | 2-120 | ATEERMRILRLIENGQLTAEEGARLLGVMEPNNRVSRPPRAQWVRIRVTDLKSNHHKINVNIPVGLISIGLKLGARFASNKHTTLNF… |
| A0A7W0SR31 | 11-144 | None |
| A0A7C5G2S7 | 9-163 | None |
| A0A847HVG5 | 2-142 | None |
| A0A2G9Y312 | 1-147 | None |
| A0A7V8L0V5 | 2-131 | None |
| A0A4Q2WST5 | 1-138 | None |
| A0A2W4KS29 | 1-116 | None |
| A0A0R0FGL1 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.