DPCstruct | MC13106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 125 ± 19 aa |
| Standard deviation of domain lengths | 18.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101N4Y7 | 4-99 | PRYTSTVSTAGVWWRKIELRYHSRTRCAWGRISNGSRGDSVWVDWSANGGQTWKQLDVTKIPRGGHEVHTVAHNDAGYVMRACGKAG… |
| A9B6N8 | 7-127 | VSTYAATCSGTGCNGKDPQASGCASGATTVATAYFTGGYVELRWSATCQTNWARVVSTSGNKYLKAYIVQQNVGELYASNVYGQSTY… |
| A0A4D4N5A0 | 29-153 | None |
| A0A4D4KA16 | 7-103 | None |
| A0A3Q9EPP8 | 3-99 | None |
| A0A066YQW2 | 22-181 | None |
| A0A178X9C4 | 94-198 | None |
| A0A4R4W6I2 | 2-124 | None |
| A0A2P9IK48 | 53-185 | None |
| A0A229SRE6 | 7-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.