DPCstruct | MC13104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 146 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 56.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6DBQ7 | 1-154 | MLRDANPRELDQIVVENVLAFDAGFWVRLAARIDICKSDDDKKDYEELAENVMNIVDRLVHKTDIEQSTDVLKEIISPAIHEGDVKW… |
| V4NII0 | 81-237 | LQDANPRELEQLVVENILAFDEVFWIRLAARSDTCKSDDDKKDYEELAATVMSIVDCVVNKTREKIETSTDVLKGILRPVVEGVEEI… |
| A0A812ZAZ9 | 161-291 | None |
| V4L6R6 | 5-161 | None |
| D7FX94 | 4-138 | None |
| A0A287FDG3 | 1-131 | None |
| A0A7J6FI95 | 93-231 | None |
| A0A200Q6T9 | 81-246 | None |
| A0A3P5Z5X0 | 24-140 | None |
| V4SCZ2 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.