DPCstruct | MC13100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 122 ± 28 aa |
| Standard deviation of domain lengths | 28.15 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 77.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W0V3C6 | 13-114 | DLLSGVMGLINNAGGLPGLLQKLQESGLGDQVASWIGHGENAAVSGDQIKDALGSDTLAKIAEQAGVAPEHASTGLAQLLPQIIDKL… |
| C7QCU1 | 53-170 | SAAPSSGGAGGLGGLLSSGMVQKLAPMLGSLVAGGGLAKLMEQLKGGGLGSQAKSWVSTEQPNQPVSGEQLTQALGTEQISQFANTL… |
| A0A4R7CB55 | 202-319 | None |
| A0A4R5QMR0 | 79-198 | None |
| A0A349X5H5 | 21-135 | None |
| A0A5M6IM66 | 1-170 | None |
| A0A2U9UBE0 | 110-230 | None |
| A0A372JTA3 | 7-89 | None |
| A0A1W6N113 | 6-88 | None |
| A0A521VSZ8 | 31-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.