DPCstruct | MC1310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H8NIM1 | 4-112 | RHPAERRAARVSAWRSVGAALARLGDRRIADLLAGATPLGSGIGGRSAVLEVAGVPVFVKRVPLTERELRPEHARSTANLFGLPTWY… |
| A0A7U3UMX6 | 14-125 | PTKEETSSDHAARVFAYATVGARLSLFSDRRLADAVAAAPGLGSGIGGRAAEMDVEGRRVFVKRVPLTDTELRPEHRRSTANVFELP… |
| A0A0W0YJ79 | 2-116 | None |
| A0A7K0D8D7 | 22-123 | None |
| A0A559V1A4 | 5-108 | None |
| A0A2S6XHK5 | 10-114 | None |
| A0A5R8PD99 | 1-89 | None |
| A0A7W1CJB6 | 96-198 | None |
| A0A5B0HBR0 | 1-105 | None |
| A0A1C4KTQ2 | 10-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.