DPCstruct | MC131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 243 ± 36 aa |
| Standard deviation of domain lengths | 36.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3H653 | 171-354 | EEEPWFDGFESGFEVPYNPTTNLEYLKRAGASVMPPSSSMGVVESVAHKFQIASGLVSAQSTHSAIHLARINRGGGSIFESPEAKAV… |
| A0A364LAB2 | 31-278 | LRLRRGTPIRGRPGATGGAAGRPNAKGRGANAAGPRRQRRRRDDDEDPSEGGRENDVEAVFKEVRDASRPKTVRYTPVTYDATTLKD… |
| A0A6A6URU8 | 46-260 | None |
| A0A5N5X1M7 | 96-346 | None |
| D4D1W0 | 1-231 | None |
| Q2HFE3 | 58-328 | None |
| A0A2T3AGD0 | 191-527 | None |
| A0A0N0NIW2 | 75-321 | None |
| N4UQD3 | 288-571 | None |
| A0A2I0S427 | 206-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.