DPCstruct | MC13096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Standard deviation of domain lengths | 13.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 34.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1J6U0 | 2-148 | PAHWTYPAHIASAAQCTPVSAALKVARHAHCGHGWRHIPASDSPYAPLPPVDIPAQQPCACPGATPPTSVDVASGEQQATRMDALTS… |
| A0A0C3QLK6 | 5-117 | TFIYPAVAKDLEHLSDSSRSIRIARHSPCSSCSCHGLHPPDGTPIVLDNSEDYQDALDQADQSETPTDEGFWMVCECGHGWEEHGAG… |
| A0A316UET2 | 39-154 | None |
| W4KJX5 | 2-136 | None |
| A0A0H2SIS7 | 1-104 | None |
| A0A397UU51 | 1-120 | None |
| A0A0K6GAA0 | 2-136 | None |
| A0A4Y7T839 | 3-128 | None |
| A0A1Y2GKZ1 | 119-254 | None |
| A0A137QUZ1 | 2-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.