DPCstruct | MC13094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09784 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0FXJ3 | 13-98 | RKVPWRLSSTRKFRVRERLRDVDHNIQAIKDSGVQFKQLDVASSLPTESAMPPRDKYFTFNKNSPTYRKGVHKVPKWTRLTQRTNP |
| A0A0C3QD35 | 71-170 | DSITSQRKWTDRKVPWRLSVPRKARQRQRLRDVDEVIEAVRQSGVQCDALTRALALPKEDEMPAKDKYTVFNRRSKGYRKGIHKVHK… |
| H2AU90 | 5-131 | None |
| A0A094GVB0 | 13-109 | None |
| F4P6Z2 | 37-126 | None |
| A0A512UEB1 | 1-83 | None |
| A0A1E3NS09 | 7-110 | None |
| A0A1V2LSY3 | 15-97 | None |
| R9NX37 | 168-262 | None |
| A0A194VKM6 | 12-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.