DPCstruct | MC13092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 7.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4G1P9 | 472-571 | AFARDLRAAGAIDRLEFSFTVQTENYREMGMLVDMAHSYGADHIAFGRLTNWGTFSAEEYAAKAVFSTSHPQHGDFIEAMQDGRLRD… |
| A0A7U9R2L4 | 406-502 | MKNMEFLSELRREGKVDFVQVNMIVQEGNYREMKDFVLWAKKLGFDRAYLSPIWNWGTYLDSEFKRISIFADRGERKMKAKVKECLK… |
| A0A0A6PBB8 | 576-673 | None |
| A0A7J0B866 | 1-92 | None |
| A0A6N7J168 | 1-79 | None |
| A0A2T6KMX7 | 369-473 | None |
| A0A1G5C825 | 419-512 | None |
| A0A2E6UQB6 | 699-781 | None |
| A0A430EJH6 | 155-253 | None |
| A0A163DUT3 | 394-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.