DPCstruct | MC1309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 176 ± 44 aa |
| Standard deviation of domain lengths | 44.47 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9VPZ8 | 1-125 | MIERVLAVSARHYTEVTGTDSEQWDEETSRELVGIALRTVRLAEREDYPRALEEYLRANRVRLGRLWQRYGPDGLFPRGVYHLVELP… |
| A0A7U3LGD5 | 44-185 | PGRPVPLVPPAEGPPVPPANVDEVLAAAVRIARTFIPGGTFDTATSREVLSVVLTAVREKERADYVARLDEFAARHHDRLERLFREY… |
| A0A543HFZ5 | 198-439 | None |
| A0A7S7UP67 | 190-431 | None |
| A0A4D4KQV8 | 105-245 | None |
| A0A101NYN1 | 3-147 | None |
| A0A6B1PXN2 | 233-385 | None |
| R7GKM1 | 1-268 | None |
| A1SQN0 | 819-1039 | None |
| G2PHD1 | 292-444 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.