DPCstruct | MC13087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 157 ± 20 aa |
| Standard deviation of domain lengths | 20.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06140 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5UIY0 | 12-148 | TPSNRSLSPANHRSPESVASEIVTKILKADTRCSLQKELNELIRINGWSDTVAKAILDGLQNAIENGTEMARAATEALAQSKEAAAS… |
| A0A6A6J3P1 | 6-164 | QAIISCITGAEPTIEAYPDEKQAILCAHEPRTAEAIADEVLQAIQSAEKCGRQLQAKLNEIVGEYGWTERVAEWLLVKLEQVLKAAD… |
| A0A0C4E1A9 | 90-237 | None |
| A0A162VXX7 | 276-435 | None |
| L7I5A6 | 3-155 | None |
| A0A4S9B4D2 | 5-209 | None |
| A0A5N5DFJ9 | 1-126 | None |
| A0A423VGS7 | 150-315 | None |
| H0EEG7 | 81-246 | None |
| W6ZLU4 | 3-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.