DPCstruct | MC13083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 323 ± 30 aa |
| Standard deviation of domain lengths | 29.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4Q7M1 | 1-325 | MSEDEDISATKSEILRPDVVAYSTENESLVLIELKNFSTPTREAGTELVAYAAELKSYLSYLSDGDITNVLISPDWPPLVRHFIFNM… |
| A0A0P9YXY1 | 1-296 | MLIKKEFPLENSHGAGGSIDILAKDKLGHYVVIEIKRSDQVARAALLRSTKGIRRENIRTILLSTTWHELRVPFQEYCRVCEVPSEG… |
| A0A1N7GUT2 | 73-400 | None |
| A0A7W2EMA8 | 4-384 | None |
| A0A2S4HT18 | 22-375 | None |
| A0A2S9QLG8 | 33-325 | None |
| D4B830 | 25-376 | None |
| A0A0Q6WRZ1 | 2-322 | None |
| A0A0D6PX94 | 73-396 | None |
| A0A1H1MDN0 | 28-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.