DPCstruct | MC13080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 220 ± 15 aa |
| Standard deviation of domain lengths | 14.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9SWU4 | 1-200 | MPLTQIHLAAMRRLIEDVRAVGDEGESIHRELSGLLDQADLGSRDAAPVRTAGDWLISQVPMLRRRLALAEEVEASTPGIQASVQID… |
| A0A2P8DM59 | 3-233 | MASIDLGHMADLVKALEDASTEVGERAGRVRYNLSDVHLSTDALNRVNGVEAWIDDQLPGVRRRLALARHVEAQEPGPQTFAEIDES… |
| A0A7W8F797 | 1-220 | None |
| A0A5J6V758 | 1-213 | None |
| A0A5S4EW79 | 2-199 | None |
| A0A2W6V9P7 | 2-234 | None |
| A0A4Y4K6F7 | 4-234 | None |
| A0A418KI08 | 13-225 | None |
| A0A1Q9T2X0 | 1-250 | None |
| A0A4R4RWJ5 | 140-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.