DPCstruct | MC1308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 223 ± 19 aa |
| Standard deviation of domain lengths | 18.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5BD73 | 28-227 | QTVEAGTDLWATASPVTLDIGGIGPVDFCGAPPVDPTLWGLPPGTDTGNADTVVQRLSDGDLSGGPATIPIEIVALSLTSCAPITVD… |
| A0A2V7YYS1 | 20-198 | ALPAAAQVINPGNDFWTTPANGQTYFTFPSGDVESLCGAVLSNTWDHKLVLQGTPLGNPAYDTVVARLDQAVFDPTGTATTRVVVKA… |
| A0A7Y4VSZ9 | 60-291 | None |
| A0A2V7YA54 | 13-239 | None |
| A0A518LIX0 | 349-559 | None |
| A0A3A0CS55 | 388-601 | None |
| A0A6L9ZW39 | 19-223 | None |
| A0A3R9HN87 | 7-214 | None |
| A0A090AJA5 | 1-264 | None |
| E0U574 | 11-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.