DPCstruct | MC13077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 171 ± 19 aa |
| Standard deviation of domain lengths | 19.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 56.49 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0062- PF13722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q2QKH2 | 4-197 | GYGFVASILPVWFLLAPRDYLSTFLKIGVIGVLVVAIIFVAPPLQIPKITPFVDGSGPVFAGSVFPFLFITVACGTISGFHALISSG… |
| A0A4R3VMA8 | 2-149 | LAIGIVFVQPTIQMPALTDFINGGRPVIGGPVLPFIFIVIACGAISGFHAVIATGTTPKMLSKERDILFVGYGAMLVEGFVALMAMI… |
| X8ASR9 | 1-164 | None |
| A0A832FUZ2 | 200-354 | None |
| A0A087A716 | 171-396 | None |
| A0A6I1IT83 | 19-178 | None |
| A0A485CJF6 | 97-258 | None |
| A0A5S5CWW5 | 26-189 | None |
| A0A6D0EQD7 | 1-141 | None |
| A0A3S4IW15 | 115-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.