DPCstruct | MC13074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800B0T1 | 66-145 | KFEANHWSEYRGYDLDKDGIGDVPHRPLKLFSFITTNTPDSVVLLRSLFVDIINFSEQVSPIFTPENLVDKKPIIKVIDA |
| A0A7Y1XEP0 | 1-86 | SGNLNSNKFENNYWSNYTGYDLNKDGIGDIPYRPVKLFSYLVNRTPESIVLLRSLFIDLIDFSEKVSPVFTPENLIDNQPLMTQVT |
| A0A3M1H1D3 | 4-84 | None |
| A0A847BIL4 | 109-194 | None |
| A0A3M1R6I0 | 81-163 | None |
| A0A354A3T5 | 351-431 | None |
| A0A538PQ27 | 105-180 | None |
| A0A7C3QMD7 | 15-104 | None |
| A0A7C7QE56 | 5-92 | None |
| A0A2D5VGT9 | 400-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.