DPCstruct | MC13072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 210 ± 34 aa |
| Standard deviation of domain lengths | 34.20 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10593 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S4LEI4 | 63-247 | LARFCITVAHLNLAATKSGQRERNFSFLVHTSGKTSDHATDRNTIETTMNALVGMTGAAFNAFVVMLHAEAQSLYPQDDSDALIKYV… |
| A0A2N4SXU1 | 8-254 | FVLSGAIKLFREAKGRKSNGWQPEPYRFRHHTMLVHESMKQADHSDLAELVRQVWQESNYQAASALQRLDALWKNDFQPVSAARAEA… |
| A0A1X3A6B1 | 49-261 | None |
| A0A0F3QFL3 | 55-219 | None |
| A0A379ZH63 | 6-215 | None |
| A0A4R6PT45 | 470-665 | None |
| A0A7Z0KQZ3 | 1-271 | None |
| A0A7Z7GFP4 | 169-333 | None |
| A0A524RVT2 | 168-374 | None |
| A0A7V9J4V7 | 129-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.