DPCstruct | MC13070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 131 ± 5 aa |
| Standard deviation of domain lengths | 4.60 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1TVC8 | 7-132 | LNIKGTVLDRYQLEQYLEKIASDHILTEKSAKDTYPIPRLKENFFVIKEIYKLLNEQIKQGIPIHPAGEWILDNLYVIEEIVKNISK… |
| A0A1Q6LFS4 | 5-138 | KKLQINGTMLEKEQLKKHLEKIASSHNIINKSQKDTYPVPELIKDYEIIKEVYKMLNQHVSMKINIHPAGEWLLDNFYIIEETVKQI… |
| A0A2V9RQ53 | 160-284 | None |
| A0A2V8EFP5 | 9-146 | None |
| A0A1F9NEB3 | 34-162 | None |
| A0A2V8MDE1 | 22-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.