DPCstruct | MC1307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 384 ± 47 aa |
| Standard deviation of domain lengths | 46.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7YTN5 | 4-381 | QPASGINPSFFAETWLQNWTANQTINSFGVPSRLQMQAIINQWRAASGGGKLDLTKAPLRLLAIVSRVDLRRTTGGGGGYSGNATGN… |
| A0A1Q3HN31 | 19-429 | IRRSLAVTEKSILARFGGRRVFSKLVADNGGAGFTPEQLFRQLWDTQNPAPGQPDLPGMPHCTDAGNTLNGFPYVCRPSEGGQARRD… |
| A0A1H6LR67 | 54-472 | None |
| A0A4Q6G2P7 | 302-656 | None |
| A0A7Y4ZF02 | 6-284 | None |
| A0A5C7X8C3 | 213-652 | None |
| A0A538PVG4 | 7-363 | None |
| A0A7W0QBF7 | 110-436 | None |
| A0A511TH40 | 52-489 | None |
| A0A7C8CL36 | 3-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.