DPCstruct | MC13069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 2.84 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416DFX2 | 144-209 | CQFVMWKNDRFFEQRGKVFTFKIAAALLKDGKTKVKGLRSLRTGKTYDGTIVLADTGGKYVNYRIE |
| K1TRN3 | 1-65 | MWKNDRFFTSKRKEITKKMASDLLAKGRTKVKGLYSEKKDKTYDADVVLIDSNDKYVHFRLDFDG |
| R6LKS7 | 247-309 | None |
| A0A1G5DHH7 | 91-156 | None |
| A0A1H7Y8Q7 | 7-72 | None |
| A0A4R7SZK4 | 73-136 | None |
| A0A3E2V1K0 | 165-230 | None |
| A0A6N3GSF1 | 25-92 | None |
| A0A564T826 | 120-185 | None |
| J4VP75 | 454-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.