DPCstruct | MC13067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 6.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I8AER3 | 1-54 | MKRGEIYYADLSLTLGSEMGKLRPVLIVSNDISNRVATTVTILPLTSNVTRVYK |
| K1TKP0 | 1-64 | MFEKFHRGDIYSADLSPGIGSEQSGSRPVLILQNNVGNCFSPTIIIAAITSVSKKAESSPRITT |
| A0A221BQS2 | 95-153 | None |
| A0A7C6CR94 | 2-56 | None |
| A0A7C9PRJ5 | 1-47 | None |
| A0A7T6Z1F4 | 28-89 | None |
| A0A6I5NNY8 | 1-50 | None |
| H7G105 | 1-67 | None |
| A0A291TD33 | 1-62 | None |
| A0A4R3JRK3 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.