DPCstruct | MC13065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 4 aa |
| Standard deviation of domain lengths | 4.40 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0627 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6A089 | 6-132 | EGLLPPLLERGIWVAVQGCEHLNRALVVEREAARAYGLEEVTVYPHPKAGGSLATAAFLRFEDPVMVESLKAQAQGGMDVGGVLIGM… |
| K1TFE3 | 13-127 | GLYLAVQCCEHLNRSLVIDAPCQERYNFDEVTVRPIAHAGGAMGTAAYENFAQPVMVERVVAHLGLDIGQTLIGMHLKRVAVPVRLQ… |
| A0A1M6BAR0 | 77-197 | None |
| A0A6I1PA22 | 1-120 | None |
| A0A7C7DNJ0 | 191-319 | None |
| A0A239HJN4 | 64-190 | None |
| X1WQA7 | 588-711 | None |
| A0A2M9A3C4 | 174-294 | None |
| A0A7V6YEV5 | 213-338 | None |
| A0A317KV09 | 65-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.