DPCstruct | MC13064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 14.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350IFX9 | 325-438 | AFEKSMMNSPCKRLISSEVETVISGDGVSGYVISVSATTEDGRRTTISCNAGTDPARNAEMMKSMVSGQLCKSSGLYNFHEAKPLQI… |
| K1TDK2 | 2-137 | VKEGTEVFISFSKSIHENLKKFQKEVIKNHIPLSLTLSWNEDLTGFVNVEYYLDDELINFRHKVIGKFEKAKNKPITKEKIEKQLSK… |
| A0A6G2CJ34 | 39-166 | None |
| A0A2X3IXH7 | 274-391 | None |
| A0A349RDV4 | 383-514 | None |
| A0A850BRF3 | 162-283 | None |
| A0A2N2B7F3 | 63-202 | None |
| A0A828T0H9 | 152-258 | None |
| A0A7K4A712 | 475-614 | None |
| A0A847DM09 | 777-891 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.