DPCstruct | MC13062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 9.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 38.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3G8I4 | 167-262 | LTAAYHHGGPHGAAACLSPRPAHPAALAAAEAAIRPLRPSPGAPLERHRDRLTDPPAGVQLRHGPDGRWYPYADLHGTWQPVAGPHG… |
| A0A7K3QSQ4 | 14-97 | LTVLEEPWDPPAGRFDRARPLLLAADLPAFRPWRNHLTHPAGHAQLRLGRDGLWYAYESEPGHDDWWPRGAPDLDPVSALTTLD |
| A0A7G6XAU1 | 266-336 | None |
| A0A845VLP4 | 57-153 | None |
| A0A845VJX5 | 35-115 | None |
| V6L5R2 | 8-91 | None |
| A0A1G7WB58 | 529-625 | None |
| A0A160NWS3 | 198-291 | None |
| A0A4R4LLH1 | 88-192 | None |
| D6B114 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.