DPCstruct | MC13059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 295 ± 63 aa |
| Standard deviation of domain lengths | 63.25 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 15.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1S5J1 | 26-328 | CGGLFCQNTPVDQQAERIIFTVNKNDTLTAYVQINYTGEAHDFSWVVPVPSVPKVDVAEIASFDELSNLTAPVFIPPLMPGCAAIPM… |
| A0A6N7PLN7 | 21-433 | QRADAAGAWLPSGPSEPIEARVAVAVGPTRSTLWTSLRVDGVEEPFAIVVPVSPGAALDHSSDAWFEALASATAPRVLGPVGVSPVC… |
| A0A2D4SL89 | 26-418 | None |
| A0A7C2AI02 | 2-365 | None |
| A0A5C6B0V3 | 10-272 | None |
| A0A2H0YTY9 | 115-414 | None |
| F2LTX4 | 22-300 | None |
| A0A7V5G9P2 | 3-258 | None |
| A0A2E6GWB1 | 2-341 | None |
| A0A661NHQ2 | 40-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.