DPCstruct | MC13058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 130 ± 12 aa |
| Standard deviation of domain lengths | 11.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6K6H5 | 174-302 | VATPDGAEEHGPLMPGDSYTFEVEAGHDHNLTLATMFVQSNDLFYAPEPSGISLFEDGDPLSGDVTDELVLWDAGTEQNQEPGVGAD… |
| A0A7V3UK88 | 31-162 | GVFNTPVGASKPGPLTPGKAYEFTFQATPGSKLSLAMMFGQSNDLFYAPEEAGIPLFDTKNKPVGGDVTSQILLWDAGTEVNQEPGV… |
| A0A534NAK3 | 1-135 | None |
| A0A077EDF1 | 209-317 | None |
| A0A848J8V2 | 9-124 | None |
| A0A521QFS1 | 107-243 | None |
| A0A2R6K3V5 | 337-473 | None |
| A0A3D3TH38 | 46-171 | None |
| U1PDM7 | 102-225 | None |
| A0A2T2T4M4 | 446-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.