DPCstruct | MC13054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 20.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01899 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8F8V5 | 2-127 | AALIVSFLTYEIFVPSRGENVLLKIRRLIPYIGWELWQIYLATIDVTKRVLGILPVDPRIIEFDTTLRSDFALVTFANSITLTPGTI… |
| A0A7W0FLA8 | 2-152 | SFYIIINLFLALAWAALLGSFSPQNLLFGYLLGFLVLFLSRRALPQSKYFEKVPKGVVFFLFFLWELLKASIRVAIDVLSPKHHMRP… |
| A0A7C3EE49 | 47-211 | None |
| E3J8G4 | 2-177 | None |
| A0A897MZV8 | 121-279 | None |
| A0A227LEL7 | 23-167 | None |
| A0A651EBL1 | 4-152 | None |
| A0A1Y2MLM5 | 194-370 | None |
| A0A133UH18 | 13-192 | None |
| H0QXN6 | 36-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.