DPCstruct | MC1305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 263 ± 24 aa |
| Standard deviation of domain lengths | 23.78 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661EZE0 | 2-217 | EEITLMGSYGIAAMTFMGLTRKIFDKIGLRQISIHDEIMAGNVAAGIVDAFNLIATAIIIRAAMSWVDGSTFLGLAIVVGIFLISQI… |
| A0A150AQW4 | 14-284 | MSCIYILIFAVILLISKFLKKIIYKDNVDVQLTEKDNVAYGISIGGYFVGVFAIYIGALVGPSVDLLHDIMNVSIYALGGIAVMFLS… |
| A0A3T0VZ48 | 6-274 | None |
| A0A5Q4G602 | 44-313 | None |
| A0A358EQC6 | 68-357 | None |
| A0A401I1U4 | 20-240 | None |
| A0A534Z2Y2 | 6-246 | None |
| A0A2E7L5L8 | 12-292 | None |
| A0A7S0NGR3 | 170-449 | None |
| A0A7S1HZM0 | 25-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.