DPCstruct | MC13049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H4GM71 | 3-109 | ISKTAILDKTHYGLRIYSHVLRHYYPGETVLSLSGRDCQPTKNPFNDNKPTLKIQIVNNCAEHYDLENSISKGDAFDFAALHYQLQG… |
| L1MTE9 | 1-101 | MMDKERILALTDGGLRVFCHYLGFEVNLHRNFRSPFYDDKRASCHIYYDKRSSTYKYYDHGNPSYAGDCFWFVSELRGIDLKTSFPE… |
| A0A845PVQ1 | 2-127 | None |
| A0A843GLT8 | 3-103 | None |
| K0PB33 | 1-112 | None |
| C2MEK3 | 1-125 | None |
| A0A645FUG7 | 1-123 | None |
| A0A0K9XWW6 | 5-134 | None |
| A0A212FYI3 | 5-109 | None |
| A0A832L8K2 | 3-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.