DPCstruct | MC13047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 120 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11644 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1MCI2 | 10-109 | LESLFYAVPLAILPLLNSGARLDLWDLHRAEQYAAVSNNLNGETSLEKVDANSLTLRYTPASTWKMELLPDSTIRITRTFFARDTSQ… |
| D1PUI3 | 2-103 | TELWQSIPDSIIPYIERSQRQEMTDFIAMGAEAKVRHALQGESKMDTITSDYIHLTLNESMQMELKRLPHEGGDSILCLVKTWGGPC… |
| R6YFY4 | 266-402 | None |
| A0A352IDE8 | 96-216 | None |
| A0A3D4RQY4 | 11-128 | None |
| A0A255S2Q8 | 14-124 | None |
| A0A1Q6HNI7 | 18-155 | None |
| U2J1G7 | 1-118 | None |
| A0A3N2MC99 | 44-148 | None |
| A0A2A6E6L3 | 12-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.